Tnfrsf4 (Mouse) Recombinant Protein, Human

Artikelnummer: ABN-P10607
Artikelname: Tnfrsf4 (Mouse) Recombinant Protein, Human
Artikelnummer: ABN-P10607
Hersteller Artikelnummer: P10607
Alternativnummer: ABN-P10607-100
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Mouse
Mouse Tnfrsf4 partial recombinant protein with His tag expressed in HEK293 cells.
Tag: His (C-term)
UniProt: 22163
Puffer: Lyophilized from filtered PBS, pH 7.4.
Reinheit: >=95% by SDS-PAGE
Formulierung: Lyophilized
Sequenz: VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP
Target-Kategorie: Tnfrsf4
Application Verdünnung: SDS-PAGEThe optimal working dilution should be determined by the end user.