Tnfrsf4 (Mouse) Recombinant Protein, Human
Catalog Number:
ABN-P10607
| Article Name: |
Tnfrsf4 (Mouse) Recombinant Protein, Human |
| Biozol Catalog Number: |
ABN-P10607 |
| Supplier Catalog Number: |
P10607 |
| Alternative Catalog Number: |
ABN-P10607-100 |
| Manufacturer: |
Abnova |
| Host: |
Human |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Mouse |
| Mouse Tnfrsf4 partial recombinant protein with His tag expressed in HEK293 cells. |
| Tag: |
His (C-term) |
| UniProt: |
22163 |
| Buffer: |
Lyophilized from filtered PBS, pH 7.4. |
| Purity: |
>=95% by SDS-PAGE |
| Form: |
Lyophilized |
| Sequence: |
VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP |
| Target: |
Tnfrsf4 |
| Application Dilute: |
SDS-PAGEThe optimal working dilution should be determined by the end user. |
