LGR5 Antibody : Biotin (ARP59640_P050-Biotin), Rabbit, Polyclonal
Artikelnummer:
ASB-ARP59640_P050-BIOTIN
- Bilder (0)
| Artikelname: | LGR5 Antibody : Biotin (ARP59640_P050-Biotin), Rabbit, Polyclonal |
| Artikelnummer: | ASB-ARP59640_P050-BIOTIN |
| Hersteller Artikelnummer: | ARP59640_P050-Biotin |
| Alternativnummer: | ASB-ARP59640_P050-BIOTIN-100UL |
| Hersteller: | Aviva |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG |
| Konjugation: | Biotin |
| Alternative Synonym: | FEX, HG38, GPR49, GPR67, GRP49 |
