LGR5 Antibody : Biotin (ARP59640_P050-Biotin), Rabbit, Polyclonal

Catalog Number: ASB-ARP59640_P050-BIOTIN
Article Name: LGR5 Antibody : Biotin (ARP59640_P050-Biotin), Rabbit, Polyclonal
Biozol Catalog Number: ASB-ARP59640_P050-BIOTIN
Supplier Catalog Number: ARP59640_P050-Biotin
Alternative Catalog Number: ASB-ARP59640_P050-BIOTIN-100UL
Manufacturer: Aviva
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG
Conjugation: Biotin
Alternative Names: FEX, HG38, GPR49, GPR67, GRP49
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 100 kDa
NCBI: 8549
UniProt: O75473
Form: Liquid. Purified antibody supplied in 1x PBS buffer.