AICDA Antibody : HRP (ARP63254_P050-HRP), Rabbit, Polyclonal
Artikelnummer:
ASB-ARP63254_P050-HRP
- Bilder (0)
| Artikelname: | AICDA Antibody : HRP (ARP63254_P050-HRP), Rabbit, Polyclonal |
| Artikelnummer: | ASB-ARP63254_P050-HRP |
| Hersteller Artikelnummer: | ARP63254_P050-HRP |
| Alternativnummer: | ASB-ARP63254_P050-HRP-100UL |
| Hersteller: | Aviva |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT |
| Konjugation: | HRP |
| Alternative Synonym: | AID, ARP2, CDA2, HIGM2, HEL-S-284 |
