AICDA Antibody : HRP (ARP63254_P050-HRP), Rabbit, Polyclonal
Catalog Number:
ASB-ARP63254_P050-HRP
- Images (0)
| Article Name: | AICDA Antibody : HRP (ARP63254_P050-HRP), Rabbit, Polyclonal |
| Biozol Catalog Number: | ASB-ARP63254_P050-HRP |
| Supplier Catalog Number: | ARP63254_P050-HRP |
| Alternative Catalog Number: | ASB-ARP63254_P050-HRP-100UL |
| Manufacturer: | Aviva |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT |
| Conjugation: | HRP |
| Alternative Names: | AID, ARP2, CDA2, HIGM2, HEL-S-284 |
Product Guarantee and Expert Support
