Anti-SETD2
Artikelnummer:
ATA-HPA042451
- Bilder (9)
| Artikelname: | Anti-SETD2 |
| Artikelnummer: | ATA-HPA042451 |
| Hersteller Artikelnummer: | HPA042451 |
| Alternativnummer: | ATA-HPA042451-100,ATA-HPA042451-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ23184, HIF-1, HYPB, KIAA1732, KMT3A |
| SET domain containing 2 |
| Anti-SETD2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 29072 |
| UniProt: | Q9BYW2 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NLGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAPPPVPVVPHVAAPVEVSSSQYVA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SETD2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles & cytosol. |
|
|
Immunohistochemical staining of human endometrium shows strong nuclear positivity in glandular and stromal cells. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human small intestine shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in Purkinje cells as well as in cells in molecular layer. |
|
|
HPA042451-100ul |
|
|
|
|
|
HPA042451-100ul |
|
|
HPA042451-100ul |
Produktgarantie und fachkundiger Support
