Anti-SETD2
Catalog Number:
ATA-HPA042451
- Images (9)
| Article Name: | Anti-SETD2 |
| Biozol Catalog Number: | ATA-HPA042451 |
| Supplier Catalog Number: | HPA042451 |
| Alternative Catalog Number: | ATA-HPA042451-100,ATA-HPA042451-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ23184, HIF-1, HYPB, KIAA1732, KMT3A |
| SET domain containing 2 |
| Anti-SETD2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 29072 |
| UniProt: | Q9BYW2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NLGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAPPPVPVVPHVAAPVEVSSSQYVA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SETD2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles & cytosol. |
|
|
Immunohistochemical staining of human endometrium shows strong nuclear positivity in glandular and stromal cells. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human small intestine shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in Purkinje cells as well as in cells in molecular layer. |
|
|
HPA042451-100ul |
|
|
|
|
|
HPA042451-100ul |
|
|
HPA042451-100ul |
Product Guarantee and Expert Support
