Anti-DENND1C
Artikelnummer:
ATA-HPA042758
- Bilder (9)
| Artikelname: | Anti-DENND1C |
| Artikelnummer: | ATA-HPA042758 |
| Hersteller Artikelnummer: | HPA042758 |
| Alternativnummer: | ATA-HPA042758-100,ATA-HPA042758-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FAM31C, FLJ22757 |
| DENN/MADD domain containing 1C |
| Anti-DENND1C |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 79958 |
| UniProt: | Q8IV53 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PSPPESPQILAPTKPNFDIAWTSQPLDPSSDPSSLEDPRARPPKALLAERAHLQPREEPGALNSPATPTSNCQKSQPSSRPRVADLKKCFE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DENND1C |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human lymph node and liver tissues using Anti-DENND1C antibody. Corresponding DENND1C RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human bone marrow, colon, liver and lymph node using Anti-DENND1C antibody HPA042758 (A) shows similar protein distribution across tissues to independent antibody HPA042839 (B). |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human lymph node shows high expression. |
|
|
Immunohistochemical staining of human bone marrow using Anti-DENND1C antibody HPA042758. |
|
|
Immunohistochemical staining of human colon using Anti-DENND1C antibody HPA042758. |
|
|
HPA042758-100ul |
|
|
HPA042758-100ul |
|
|
HPA042758-100ul |
Produktgarantie und fachkundiger Support
