Anti-DENND1C
Catalog Number:
ATA-HPA042758
- Images (9)
| Article Name: | Anti-DENND1C |
| Biozol Catalog Number: | ATA-HPA042758 |
| Supplier Catalog Number: | HPA042758 |
| Alternative Catalog Number: | ATA-HPA042758-100,ATA-HPA042758-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FAM31C, FLJ22757 |
| DENN/MADD domain containing 1C |
| Anti-DENND1C |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 79958 |
| UniProt: | Q8IV53 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PSPPESPQILAPTKPNFDIAWTSQPLDPSSDPSSLEDPRARPPKALLAERAHLQPREEPGALNSPATPTSNCQKSQPSSRPRVADLKKCFE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DENND1C |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human lymph node and liver tissues using Anti-DENND1C antibody. Corresponding DENND1C RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human bone marrow, colon, liver and lymph node using Anti-DENND1C antibody HPA042758 (A) shows similar protein distribution across tissues to independent antibody HPA042839 (B). |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human lymph node shows high expression. |
|
|
Immunohistochemical staining of human bone marrow using Anti-DENND1C antibody HPA042758. |
|
|
Immunohistochemical staining of human colon using Anti-DENND1C antibody HPA042758. |
|
|
HPA042758-100ul |
|
|
HPA042758-100ul |
|
|
HPA042758-100ul |
Product Guarantee and Expert Support
