Recombinant Human Folate receptor beta (FOLR2), partial, Unconjugated, Virus

Artikelnummer: BIM-RPC20627
Artikelname: Recombinant Human Folate receptor beta (FOLR2), partial, Unconjugated, Virus
Artikelnummer: BIM-RPC20627
Hersteller Artikelnummer: RPC20627
Alternativnummer: BIM-RPC20627-20UG,BIM-RPC20627-100UG,BIM-RPC20627-1MG
Hersteller: Biomatik Corporation
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Folate receptor 2Folate receptor, fetal/placentalPlacental folate-binding protein
Recombinant Human Folate receptor beta (FOLR2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: FOLR2. Target Synonyms: Folate receptor 2Folate receptor, fetal/placentalPlacental folate-binding protein. Accession Number: P14207. Expression Region: 19~230aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 27.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 27.1kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN
Target-Kategorie: FOLR2