Recombinant Human Folate receptor beta (FOLR2), partial, Unconjugated, Virus

Catalog Number: BIM-RPC20627
Article Name: Recombinant Human Folate receptor beta (FOLR2), partial, Unconjugated, Virus
Biozol Catalog Number: BIM-RPC20627
Supplier Catalog Number: RPC20627
Alternative Catalog Number: BIM-RPC20627-20UG,BIM-RPC20627-100UG,BIM-RPC20627-1MG
Manufacturer: Biomatik Corporation
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Folate receptor 2Folate receptor, fetal/placentalPlacental folate-binding protein
Recombinant Human Folate receptor beta (FOLR2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: FOLR2. Target Synonyms: Folate receptor 2Folate receptor, fetal/placentalPlacental folate-binding protein. Accession Number: P14207. Expression Region: 19~230aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 27.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 27.1kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN
Target: FOLR2