Recombinant Mouse Plasma serine protease inhibitor (Serpina5), Unconjugated, Virus

Artikelnummer: BIM-RPC20654
Artikelname: Recombinant Mouse Plasma serine protease inhibitor (Serpina5), Unconjugated, Virus
Artikelnummer: BIM-RPC20654
Hersteller Artikelnummer: RPC20654
Alternativnummer: BIM-RPC20654-20UG,BIM-RPC20654-100UG,BIM-RPC20654-1MG
Hersteller: Biomatik Corporation
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Plasminogen activator inhibitor 3PAI-3PAI3Protein C inhibitorPCISerpin A5Pci
Recombinant Mouse Plasma serine protease inhibitor (Serpina5) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Serpina5. Target Synonyms: Plasminogen activator inhibitor 3PAI-3PAI3Protein C inhibitorPCISerpin A5Pci. Accession Number: P70458. Expression Region: 25~405aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 45.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 45.3kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: SKKKKAKESSVGAVGPPSSKDFAFRLYRALVSESPGQNVFFSPLSVSMSLGMLSLGAGLKTKTQILDGLGLSLQQGQEDKLHKGFQQLLQRFRQPSDGLQLSLGSALFKDPAVHIRDDFLSAMKTLYMSDTFSTNFGNPEIAKKQINNYVAKQTKGKIVDFIKDLDSTHVMIVVNYIFFKAKWQTAFSETNTHKMDFHVTPKRTTQVPMMNREDGYSYYLDQNISCTVVGIPYQGNAIALFILPSEGKMKQVEDG
Target-Kategorie: Serpina5