Recombinant Mouse Plasma serine protease inhibitor (Serpina5), Unconjugated, Virus

Catalog Number: BIM-RPC20654
Article Name: Recombinant Mouse Plasma serine protease inhibitor (Serpina5), Unconjugated, Virus
Biozol Catalog Number: BIM-RPC20654
Supplier Catalog Number: RPC20654
Alternative Catalog Number: BIM-RPC20654-20UG,BIM-RPC20654-100UG,BIM-RPC20654-1MG
Manufacturer: Biomatik Corporation
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Plasminogen activator inhibitor 3PAI-3PAI3Protein C inhibitorPCISerpin A5Pci
Recombinant Mouse Plasma serine protease inhibitor (Serpina5) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Serpina5. Target Synonyms: Plasminogen activator inhibitor 3PAI-3PAI3Protein C inhibitorPCISerpin A5Pci. Accession Number: P70458. Expression Region: 25~405aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 45.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 45.3kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: SKKKKAKESSVGAVGPPSSKDFAFRLYRALVSESPGQNVFFSPLSVSMSLGMLSLGAGLKTKTQILDGLGLSLQQGQEDKLHKGFQQLLQRFRQPSDGLQLSLGSALFKDPAVHIRDDFLSAMKTLYMSDTFSTNFGNPEIAKKQINNYVAKQTKGKIVDFIKDLDSTHVMIVVNYIFFKAKWQTAFSETNTHKMDFHVTPKRTTQVPMMNREDGYSYYLDQNISCTVVGIPYQGNAIALFILPSEGKMKQVEDG
Target: Serpina5