Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha (Fcer1a), Unconjugated

Artikelnummer: BIM-RPC20732
Artikelname: Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha (Fcer1a), Unconjugated
Artikelnummer: BIM-RPC20732
Hersteller Artikelnummer: RPC20732
Alternativnummer: BIM-RPC20732-20UG,BIM-RPC20732-100UG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Fc-epsilon RI-alpha
Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha (Fcer1a) is a purified CF Transmembrane Protein. Purity: >90% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Fcer1a. Target Synonyms: Fc-epsilon RI-alpha. Accession Number: P20489. Expression Region: 24~250aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged. Theoretical MW: 44.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 44.7kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGKYKKVETELLT
Target-Kategorie: Fcer1a