Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha (Fcer1a), Unconjugated

Catalog Number: BIM-RPC20732
Article Name: Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha (Fcer1a), Unconjugated
Biozol Catalog Number: BIM-RPC20732
Supplier Catalog Number: RPC20732
Alternative Catalog Number: BIM-RPC20732-20UG,BIM-RPC20732-100UG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Fc-epsilon RI-alpha
Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha (Fcer1a) is a purified CF Transmembrane Protein. Purity: >90% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Fcer1a. Target Synonyms: Fc-epsilon RI-alpha. Accession Number: P20489. Expression Region: 24~250aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged. Theoretical MW: 44.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 44.7kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGKYKKVETELLT
Target: Fcer1a