Recombinant Human Nucleolar transcription factor 1 (UBTF), Unconjugated

Artikelnummer: BIM-RPC20765
Artikelname: Recombinant Human Nucleolar transcription factor 1 (UBTF), Unconjugated
Artikelnummer: BIM-RPC20765
Hersteller Artikelnummer: RPC20765
Alternativnummer: BIM-RPC20765-20UG,BIM-RPC20765-100UG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Autoantigen NOR-90 Upstream-binding factor 1
Recombinant Human Nucleolar transcription factor 1 (UBTF) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: UBTF. Target Synonyms: Autoantigen NOR-90 Upstream-binding factor 1. Accession Number: P17480. Expression Region: 1~764aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged. Theoretical MW: 107.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 107.9kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAFKDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDATTKEVKDSLGKQWSQLSDKKRLKWIHKALEQRKE
Target-Kategorie: UBTF