Recombinant Human Nucleolar transcription factor 1 (UBTF), Unconjugated

Catalog Number: BIM-RPC20765
Article Name: Recombinant Human Nucleolar transcription factor 1 (UBTF), Unconjugated
Biozol Catalog Number: BIM-RPC20765
Supplier Catalog Number: RPC20765
Alternative Catalog Number: BIM-RPC20765-20UG,BIM-RPC20765-100UG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Autoantigen NOR-90 Upstream-binding factor 1
Recombinant Human Nucleolar transcription factor 1 (UBTF) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: UBTF. Target Synonyms: Autoantigen NOR-90 Upstream-binding factor 1. Accession Number: P17480. Expression Region: 1~764aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged. Theoretical MW: 107.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 107.9kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAFKDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDATTKEVKDSLGKQWSQLSDKKRLKWIHKALEQRKE
Target: UBTF