Recombinant Human Thioredoxin-interacting protein (TXNIP), Unconjugated

Artikelnummer: BIM-RPC20839
Artikelname: Recombinant Human Thioredoxin-interacting protein (TXNIP), Unconjugated
Artikelnummer: BIM-RPC20839
Hersteller Artikelnummer: RPC20839
Alternativnummer: BIM-RPC20839-20UG,BIM-RPC20839-100UG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Thioredoxin-binding protein 2Vitamin D3 up-regulated protein 1
Recombinant Human Thioredoxin-interacting protein (TXNIP) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: TXNIP. Target Synonyms: Thioredoxin-binding protein 2Vitamin D3 up-regulated protein 1. Accession Number: Q9H3M7. Expression Region: 1~391aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 57.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 57.7kDa
Tag: N-Terminal 6Xhis-B2M-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGNHIISGTCASWRGKSL
Target-Kategorie: TXNIP