Recombinant Human Thioredoxin-interacting protein (TXNIP), Unconjugated

Catalog Number: BIM-RPC20839
Article Name: Recombinant Human Thioredoxin-interacting protein (TXNIP), Unconjugated
Biozol Catalog Number: BIM-RPC20839
Supplier Catalog Number: RPC20839
Alternative Catalog Number: BIM-RPC20839-20UG,BIM-RPC20839-100UG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Thioredoxin-binding protein 2Vitamin D3 up-regulated protein 1
Recombinant Human Thioredoxin-interacting protein (TXNIP) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: TXNIP. Target Synonyms: Thioredoxin-binding protein 2Vitamin D3 up-regulated protein 1. Accession Number: Q9H3M7. Expression Region: 1~391aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 57.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 57.7kDa
Tag: N-Terminal 6Xhis-B2M-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGNHIISGTCASWRGKSL
Target: TXNIP