Recombinant Mouse Arginase-2, mitochondrial (Arg2), Unconjugated, E. coli

Artikelnummer: BIM-RPC20930
Artikelname: Recombinant Mouse Arginase-2, mitochondrial (Arg2), Unconjugated, E. coli
Artikelnummer: BIM-RPC20930
Hersteller Artikelnummer: RPC20930
Alternativnummer: BIM-RPC20930-20UG,BIM-RPC20930-100UG,BIM-RPC20930-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Kidney-type arginase, Non-hepatic arginaseType II arginase
Recombinant Mouse Arginase-2, mitochondrial (Arg2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Arg2. Target Synonyms: Kidney-type arginase, Non-hepatic arginaseType II arginase. Accession Number: O08691. Expression Region: 23~354aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 52.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 52.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: VHSVAIVGAPFSRGQKKLGVEYGPAAIREAGLLKRLSRLGCHLKDFGDLSFTNVPQDDPYNNLVVYPRSVGLANQELAEVVSRAVSGGYSCVTMGGDHSLAIGTIIGHARHRPDLCVIWVDAHADINTPLTTVSGNIHGQPLSFLIKELQDKVPQLPGFSWIKPCLSPPNIVYIGLRDVEPPEHFILKNYDIQYFSMREIDRLGIQKVMEQTFDRLIGKRQRPIHLSFDIDAFDPKLAPATGTPVVGGLTYREGV
Target-Kategorie: Arg2