Recombinant Mouse Arginase-2, mitochondrial (Arg2), Unconjugated, E. coli

Catalog Number: BIM-RPC20930
Article Name: Recombinant Mouse Arginase-2, mitochondrial (Arg2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20930
Supplier Catalog Number: RPC20930
Alternative Catalog Number: BIM-RPC20930-20UG,BIM-RPC20930-100UG,BIM-RPC20930-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Kidney-type arginase, Non-hepatic arginaseType II arginase
Recombinant Mouse Arginase-2, mitochondrial (Arg2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Arg2. Target Synonyms: Kidney-type arginase, Non-hepatic arginaseType II arginase. Accession Number: O08691. Expression Region: 23~354aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 52.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 52.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: VHSVAIVGAPFSRGQKKLGVEYGPAAIREAGLLKRLSRLGCHLKDFGDLSFTNVPQDDPYNNLVVYPRSVGLANQELAEVVSRAVSGGYSCVTMGGDHSLAIGTIIGHARHRPDLCVIWVDAHADINTPLTTVSGNIHGQPLSFLIKELQDKVPQLPGFSWIKPCLSPPNIVYIGLRDVEPPEHFILKNYDIQYFSMREIDRLGIQKVMEQTFDRLIGKRQRPIHLSFDIDAFDPKLAPATGTPVVGGLTYREGV
Target: Arg2