Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC20931
Artikelname: Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC20931
Hersteller Artikelnummer: RPC20931
Alternativnummer: BIM-RPC20931-20UG,BIM-RPC20931-100UG,BIM-RPC20931-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: B120BRG1-associated factor 250BAF250BRG1-associated factor 250aBAF250AOsa homolog 1hOSA1SWI-like proteinSWI/SNF complex protein p270SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1hELDC1orf4, OSA1, SMARCF1
Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ARID1A. Target Synonyms: B120BRG1-associated factor 250BAF250BRG1-associated factor 250aBAF250AOsa homolog 1hOSA1SWI-like proteinSWI/SNF complex protein p270SWI/SNF-related, matrix-associated. Accession Number: O14497. Expression Region: 1976~2231aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 33.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 33.4kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDM
Target-Kategorie: ARID1A