Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC20931
Article Name: Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20931
Supplier Catalog Number: RPC20931
Alternative Catalog Number: BIM-RPC20931-20UG,BIM-RPC20931-100UG,BIM-RPC20931-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: B120BRG1-associated factor 250BAF250BRG1-associated factor 250aBAF250AOsa homolog 1hOSA1SWI-like proteinSWI/SNF complex protein p270SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1hELDC1orf4, OSA1, SMARCF1
Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ARID1A. Target Synonyms: B120BRG1-associated factor 250BAF250BRG1-associated factor 250aBAF250AOsa homolog 1hOSA1SWI-like proteinSWI/SNF complex protein p270SWI/SNF-related, matrix-associated. Accession Number: O14497. Expression Region: 1976~2231aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 33.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 33.4kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDM
Target: ARID1A