Recombinant Mouse ATP synthase subunit beta, mitochondrial (ATP5B), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC20957
Artikelname: Recombinant Mouse ATP synthase subunit beta, mitochondrial (ATP5B), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC20957
Hersteller Artikelnummer: RPC20957
Alternativnummer: BIM-RPC20957-20UG,BIM-RPC20957-100UG,BIM-RPC20957-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Atp5f1b, Atp5b, ATP synthase subunit beta, mitochondrial, EC 7.1.2.2, ATP synthase F1 subunit beta
Recombinant Mouse ATP synthase subunit beta, mitochondrial (ATP5B), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: ATP5B. Target Synonyms: Atp5f1b, Atp5b, ATP synthase subunit beta, mitochondrial, EC 7.1.2.2, ATP synthase F1 subunit beta. Accession Number: P56480. Expression Region: 230~529aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 52.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 52.8kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: YSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGNEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPL
Target-Kategorie: ATP5B