Recombinant Mouse ATP synthase subunit beta, mitochondrial (ATP5B), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC20957
Article Name: Recombinant Mouse ATP synthase subunit beta, mitochondrial (ATP5B), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20957
Supplier Catalog Number: RPC20957
Alternative Catalog Number: BIM-RPC20957-20UG,BIM-RPC20957-100UG,BIM-RPC20957-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Atp5f1b, Atp5b, ATP synthase subunit beta, mitochondrial, EC 7.1.2.2, ATP synthase F1 subunit beta
Recombinant Mouse ATP synthase subunit beta, mitochondrial (ATP5B), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: ATP5B. Target Synonyms: Atp5f1b, Atp5b, ATP synthase subunit beta, mitochondrial, EC 7.1.2.2, ATP synthase F1 subunit beta. Accession Number: P56480. Expression Region: 230~529aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 52.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 52.8kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: YSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGNEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPL
Target: ATP5B