Recombinant Human G1/S-specific cyclin-D1 (CCND1), Unconjugated, E. coli

Artikelnummer: BIM-RPC21045
Artikelname: Recombinant Human G1/S-specific cyclin-D1 (CCND1), Unconjugated, E. coli
Artikelnummer: BIM-RPC21045
Hersteller Artikelnummer: RPC21045
Alternativnummer: BIM-RPC21045-20UG,BIM-RPC21045-100UG,BIM-RPC21045-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: B-cell lymphoma 1 protein, BCL-1BCL-1 oncogene, PRAD1 oncogene
Recombinant Human G1/S-specific cyclin-D1 (CCND1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CCND1. Target Synonyms: B-cell lymphoma 1 protein, BCL-1BCL-1 oncogene, PRAD1 oncogene. Accession Number: P24385. Expression Region: 1~295aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 37.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 37.7kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALL
Target-Kategorie: CCND1