Recombinant Human G1/S-specific cyclin-D1 (CCND1), Unconjugated, E. coli

Catalog Number: BIM-RPC21045
Article Name: Recombinant Human G1/S-specific cyclin-D1 (CCND1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21045
Supplier Catalog Number: RPC21045
Alternative Catalog Number: BIM-RPC21045-20UG,BIM-RPC21045-100UG,BIM-RPC21045-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: B-cell lymphoma 1 protein, BCL-1BCL-1 oncogene, PRAD1 oncogene
Recombinant Human G1/S-specific cyclin-D1 (CCND1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CCND1. Target Synonyms: B-cell lymphoma 1 protein, BCL-1BCL-1 oncogene, PRAD1 oncogene. Accession Number: P24385. Expression Region: 1~295aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 37.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 37.7kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALL
Target: CCND1