Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC21079
Artikelname: Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC21079
Hersteller Artikelnummer: RPC21079
Alternativnummer: BIM-RPC21079-20UG,BIM-RPC21079-100UG,BIM-RPC21079-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Carcinoembryonic antigen CGM7Non-specific cross-reacting antigen W236
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CEACAM4. Target Synonyms: Carcinoembryonic antigen CGM7Non-specific cross-reacting antigen W236. Accession Number: O75871. Expression Region: 36~155aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 16.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 16.7kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG
Target-Kategorie: CEACAM4