Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC21079
Article Name: Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21079
Supplier Catalog Number: RPC21079
Alternative Catalog Number: BIM-RPC21079-20UG,BIM-RPC21079-100UG,BIM-RPC21079-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Carcinoembryonic antigen CGM7Non-specific cross-reacting antigen W236
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CEACAM4. Target Synonyms: Carcinoembryonic antigen CGM7Non-specific cross-reacting antigen W236. Accession Number: O75871. Expression Region: 36~155aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 16.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 16.7kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG
Target: CEACAM4