Recombinant Macaca mulatta Growth hormone receptor (GHR), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC21373
Artikelname: Recombinant Macaca mulatta Growth hormone receptor (GHR), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC21373
Hersteller Artikelnummer: RPC21373
Alternativnummer: BIM-RPC21373-20UG,BIM-RPC21373-100UG,BIM-RPC21373-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Monkey
Konjugation: Unconjugated
Alternative Synonym: Somatotropin receptor
Recombinant Macaca mulatta Growth hormone receptor (GHR), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Macaca mulatta (Rhesus macaque). Target Name: GHR. Target Synonyms: Somatotropin receptor. Accession Number: P79194. Expression Region: 19~264aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 30.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 30.2kDa
Tag: C-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: FSGSEPTAAILSRASWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQGQTQEWKECPDYVSAGENSCYFNSSFTSVWIPYCIKLTSNGDTVDGKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADILVRWEAPPNADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVLVRSKRRNSRNYGEFSEVLYVTLPQMNQFTCEEDFY
Target-Kategorie: GHR