Recombinant Macaca mulatta Growth hormone receptor (GHR), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC21373
Article Name: Recombinant Macaca mulatta Growth hormone receptor (GHR), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21373
Supplier Catalog Number: RPC21373
Alternative Catalog Number: BIM-RPC21373-20UG,BIM-RPC21373-100UG,BIM-RPC21373-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Monkey
Conjugation: Unconjugated
Alternative Names: Somatotropin receptor
Recombinant Macaca mulatta Growth hormone receptor (GHR), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Macaca mulatta (Rhesus macaque). Target Name: GHR. Target Synonyms: Somatotropin receptor. Accession Number: P79194. Expression Region: 19~264aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 30.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 30.2kDa
Tag: C-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: FSGSEPTAAILSRASWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQGQTQEWKECPDYVSAGENSCYFNSSFTSVWIPYCIKLTSNGDTVDGKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADILVRWEAPPNADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVLVRSKRRNSRNYGEFSEVLYVTLPQMNQFTCEEDFY
Target: GHR