Recombinant Macaca mulatta Uncharacterized protein (IL17A), Unconjugated, E. coli

Artikelnummer: BIM-RPC21507
Artikelname: Recombinant Macaca mulatta Uncharacterized protein (IL17A), Unconjugated, E. coli
Artikelnummer: BIM-RPC21507
Hersteller Artikelnummer: RPC21507
Alternativnummer: BIM-RPC21507-20UG,BIM-RPC21507-100UG,BIM-RPC21507-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Monkey
Konjugation: Unconjugated
Recombinant Macaca mulatta Uncharacterized protein (IL17A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Macaca mulatta (Rhesus macaque). Target Name: IL17A. Accession Number: F6T3G5. Expression Region: 24~155aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 42.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 42.1kDa
Tag: N-Terminal Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: GIAIPRNPGCPNSEDKTFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNADGNVDYHMNSVPIQQEILVLRREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA
Target-Kategorie: IL17A