Recombinant Macaca mulatta Uncharacterized protein (IL17A), Unconjugated, E. coli

Catalog Number: BIM-RPC21507
Article Name: Recombinant Macaca mulatta Uncharacterized protein (IL17A), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21507
Supplier Catalog Number: RPC21507
Alternative Catalog Number: BIM-RPC21507-20UG,BIM-RPC21507-100UG,BIM-RPC21507-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Monkey
Conjugation: Unconjugated
Recombinant Macaca mulatta Uncharacterized protein (IL17A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Macaca mulatta (Rhesus macaque). Target Name: IL17A. Accession Number: F6T3G5. Expression Region: 24~155aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 42.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 42.1kDa
Tag: N-Terminal Gst-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: GIAIPRNPGCPNSEDKTFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNADGNVDYHMNSVPIQQEILVLRREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA
Target: IL17A