Recombinant Human Interleukin-3 (IL3), Unconjugated, E. coli

Artikelnummer: BIM-RPC21518
Artikelname: Recombinant Human Interleukin-3 (IL3), Unconjugated, E. coli
Artikelnummer: BIM-RPC21518
Hersteller Artikelnummer: RPC21518
Alternativnummer: BIM-RPC21518-20UG,BIM-RPC21518-100UG,BIM-RPC21518-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Hematopoietic growth factorMast cell growth factor
Recombinant Human Interleukin-3 (IL3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: IL3. Target Synonyms: Hematopoietic growth factorMast cell growth factor. Accession Number: P08700. Expression Region: 20~152aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 17.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 17.1kDa
Tag: C-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Target-Kategorie: IL3