Recombinant Human Interleukin-3 (IL3), Unconjugated, E. coli

Catalog Number: BIM-RPC21518
Article Name: Recombinant Human Interleukin-3 (IL3), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21518
Supplier Catalog Number: RPC21518
Alternative Catalog Number: BIM-RPC21518-20UG,BIM-RPC21518-100UG,BIM-RPC21518-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Hematopoietic growth factorMast cell growth factor
Recombinant Human Interleukin-3 (IL3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: IL3. Target Synonyms: Hematopoietic growth factorMast cell growth factor. Accession Number: P08700. Expression Region: 20~152aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 17.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 17.1kDa
Tag: C-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Target: IL3