Recombinant Human Keratin, type II cytoskeletal 8 (KRT8), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC21583
Artikelname: Recombinant Human Keratin, type II cytoskeletal 8 (KRT8), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC21583
Hersteller Artikelnummer: RPC21583
Alternativnummer: BIM-RPC21583-20UG,BIM-RPC21583-100UG,BIM-RPC21583-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Cytokeratin-8, CK-8Keratin-8, K8Type-II keratin Kb8
Recombinant Human Keratin, type II cytoskeletal 8 (KRT8), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: KRT8. Target Synonyms: Cytokeratin-8, CK-8Keratin-8, K8Type-II keratin Kb8. Accession Number: P05787. Expression Region: 2~483aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 66.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 66.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: SIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDM
Target-Kategorie: KRT8