Recombinant Human Keratin, type II cytoskeletal 8 (KRT8), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC21583
Article Name: Recombinant Human Keratin, type II cytoskeletal 8 (KRT8), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21583
Supplier Catalog Number: RPC21583
Alternative Catalog Number: BIM-RPC21583-20UG,BIM-RPC21583-100UG,BIM-RPC21583-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Cytokeratin-8, CK-8Keratin-8, K8Type-II keratin Kb8
Recombinant Human Keratin, type II cytoskeletal 8 (KRT8), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: KRT8. Target Synonyms: Cytokeratin-8, CK-8Keratin-8, K8Type-II keratin Kb8. Accession Number: P05787. Expression Region: 2~483aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 66.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 66.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: SIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDM
Target: KRT8