Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), Unconjugated, E. coli

Artikelnummer: BIM-RPC21629
Artikelname: Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), Unconjugated, E. coli
Artikelnummer: BIM-RPC21629
Hersteller Artikelnummer: RPC21629
Alternativnummer: BIM-RPC21629-20UG,BIM-RPC21629-100UG,BIM-RPC21629-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Megakaryocyte-enhanced gene transcript 1 proteinC6orf23, G6D, MEGT1, NG25
Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: LY6G6D. Target Synonyms: Megakaryocyte-enhanced gene transcript 1 proteinC6orf23, G6D, MEGT1, NG25. Accession Number: O95868. Expression Region: 20~104aa. Tag Info: N-Terminal 10Xhis-B2M-Tagged. Theoretical MW: 25.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 25.5kDa
Tag: N-Terminal 10Xhis-B2M-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
Target-Kategorie: LY6G6D