Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), Unconjugated, E. coli

Catalog Number: BIM-RPC21629
Article Name: Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21629
Supplier Catalog Number: RPC21629
Alternative Catalog Number: BIM-RPC21629-20UG,BIM-RPC21629-100UG,BIM-RPC21629-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Megakaryocyte-enhanced gene transcript 1 proteinC6orf23, G6D, MEGT1, NG25
Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: LY6G6D. Target Synonyms: Megakaryocyte-enhanced gene transcript 1 proteinC6orf23, G6D, MEGT1, NG25. Accession Number: O95868. Expression Region: 20~104aa. Tag Info: N-Terminal 10Xhis-B2M-Tagged. Theoretical MW: 25.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 25.5kDa
Tag: N-Terminal 10Xhis-B2M-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
Target: LY6G6D