Recombinant Human Macrophage mannose receptor 1 (MRC1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC21684
Artikelname: Recombinant Human Macrophage mannose receptor 1 (MRC1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC21684
Hersteller Artikelnummer: RPC21684
Alternativnummer: BIM-RPC21684-20UG,BIM-RPC21684-100UG,BIM-RPC21684-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: C-type lectin domain family 13 member DC-type lectin domain family 13 member D-like, Macrophage mannose receptor 1-like protein 1, CD206
Recombinant Human Macrophage mannose receptor 1 (MRC1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MRC1. Target Synonyms: C-type lectin domain family 13 member DC-type lectin domain family 13 member D-like, Macrophage mannose receptor 1-like protein 1, CD206. Accession Number: P22897. Expression Region: 655~1213aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 80.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 80.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: RTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVTMYSNSGFW
Target-Kategorie: MRC1