Recombinant Human Macrophage mannose receptor 1 (MRC1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC21684
Article Name: Recombinant Human Macrophage mannose receptor 1 (MRC1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21684
Supplier Catalog Number: RPC21684
Alternative Catalog Number: BIM-RPC21684-20UG,BIM-RPC21684-100UG,BIM-RPC21684-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: C-type lectin domain family 13 member DC-type lectin domain family 13 member D-like, Macrophage mannose receptor 1-like protein 1, CD206
Recombinant Human Macrophage mannose receptor 1 (MRC1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MRC1. Target Synonyms: C-type lectin domain family 13 member DC-type lectin domain family 13 member D-like, Macrophage mannose receptor 1-like protein 1, CD206. Accession Number: P22897. Expression Region: 655~1213aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 80.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 80.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: RTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVTMYSNSGFW
Target: MRC1