Recombinant Entamoeba histolytica Pyruvate, phosphate dikinase (PPDK), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC22574
Artikelname: Recombinant Entamoeba histolytica Pyruvate, phosphate dikinase (PPDK), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC22574
Hersteller Artikelnummer: RPC22574
Alternativnummer: BIM-RPC22574-20UG,BIM-RPC22574-100UG,BIM-RPC22574-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Parasite
Konjugation: Unconjugated
Alternative Synonym: Pyruvate, orthophosphate dikinase
Recombinant Entamoeba histolytica Pyruvate, phosphate dikinase (PPDK), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Entamoeba histolytica. Target Name: PPDK. Target Synonyms: Pyruvate, orthophosphate dikinase. Accession Number: P37213. Expression Region: 1~342aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 54.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 54.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MQRVYAFEDGDGTNKKLLGGKGAGLCTMTKIGLPVPQGFVITTEMCKQFIANGNKMPEGLMEEVKKEYQLVEKKSGKVFGGEENPLLVSVRSGAAMSMPGMMDTILNLGLNDKTVVALAKLTNNERFAYDSYRRFVSLFGKIALNACDEVYDKTLENKKVEKGVKLDTELDANDMKELAQVFIKKTEEFTKQPFPVDPYAQLEFAICAVFRSWMGKRAVDYRREFKITPEQADGTAVSVVSMVYGNMGNDSATGV
Target-Kategorie: PPDK