Recombinant Entamoeba histolytica Pyruvate, phosphate dikinase (PPDK), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC22574
Article Name: Recombinant Entamoeba histolytica Pyruvate, phosphate dikinase (PPDK), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22574
Supplier Catalog Number: RPC22574
Alternative Catalog Number: BIM-RPC22574-20UG,BIM-RPC22574-100UG,BIM-RPC22574-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Parasite
Conjugation: Unconjugated
Alternative Names: Pyruvate, orthophosphate dikinase
Recombinant Entamoeba histolytica Pyruvate, phosphate dikinase (PPDK), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Entamoeba histolytica. Target Name: PPDK. Target Synonyms: Pyruvate, orthophosphate dikinase. Accession Number: P37213. Expression Region: 1~342aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 54.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 54.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MQRVYAFEDGDGTNKKLLGGKGAGLCTMTKIGLPVPQGFVITTEMCKQFIANGNKMPEGLMEEVKKEYQLVEKKSGKVFGGEENPLLVSVRSGAAMSMPGMMDTILNLGLNDKTVVALAKLTNNERFAYDSYRRFVSLFGKIALNACDEVYDKTLENKKVEKGVKLDTELDANDMKELAQVFIKKTEEFTKQPFPVDPYAQLEFAICAVFRSWMGKRAVDYRREFKITPEQADGTAVSVVSMVYGNMGNDSATGV
Target: PPDK