Recombinant Macaca mulatta Interleukin-15 (IL15), Unconjugated, Yeast

Artikelnummer: BIM-RPC24743
Artikelname: Recombinant Macaca mulatta Interleukin-15 (IL15), Unconjugated, Yeast
Artikelnummer: BIM-RPC24743
Hersteller Artikelnummer: RPC24743
Alternativnummer: BIM-RPC24743-20UG,BIM-RPC24743-100UG,BIM-RPC24743-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Monkey
Konjugation: Unconjugated
Alternative Synonym: IL15, Interleukin-15, IL-15
Recombinant Macaca mulatta Interleukin-15 (IL15) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Macaca mulatta (Rhesus macaque). Target Name: IL15. Target Synonyms: IL15, Interleukin-15, IL-15. Accession Number: P48092. Expression Region: 49~162aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 14.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 14.9kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANNILSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Target-Kategorie: IL15