Recombinant Macaca mulatta Interleukin-15 (IL15), Unconjugated, Yeast

Catalog Number: BIM-RPC24743
Article Name: Recombinant Macaca mulatta Interleukin-15 (IL15), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC24743
Supplier Catalog Number: RPC24743
Alternative Catalog Number: BIM-RPC24743-20UG,BIM-RPC24743-100UG,BIM-RPC24743-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Monkey
Conjugation: Unconjugated
Alternative Names: IL15, Interleukin-15, IL-15
Recombinant Macaca mulatta Interleukin-15 (IL15) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Macaca mulatta (Rhesus macaque). Target Name: IL15. Target Synonyms: IL15, Interleukin-15, IL-15. Accession Number: P48092. Expression Region: 49~162aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 14.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 14.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANNILSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Target: IL15