Recombinant Mouse Interleukin-18 (Il18), Unconjugated, Yeast

Artikelnummer: BIM-RPC24746
Artikelname: Recombinant Mouse Interleukin-18 (Il18), Unconjugated, Yeast
Artikelnummer: BIM-RPC24746
Hersteller Artikelnummer: RPC24746
Alternativnummer: BIM-RPC24746-20UG,BIM-RPC24746-100UG,BIM-RPC24746-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Interferon gamma-inducing factor
Recombinant Mouse Interleukin-18 (Il18) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Il18. Target Synonyms: Interferon gamma-inducing factor. Accession Number: P70380. Expression Region: 1~192aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 24.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 24.6kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Target-Kategorie: Il18