Recombinant Mouse Interleukin-18 (Il18), Unconjugated, Yeast

Catalog Number: BIM-RPC24746
Article Name: Recombinant Mouse Interleukin-18 (Il18), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC24746
Supplier Catalog Number: RPC24746
Alternative Catalog Number: BIM-RPC24746-20UG,BIM-RPC24746-100UG,BIM-RPC24746-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Interferon gamma-inducing factor
Recombinant Mouse Interleukin-18 (Il18) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Il18. Target Synonyms: Interferon gamma-inducing factor. Accession Number: P70380. Expression Region: 1~192aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 24.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 24.6kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Target: Il18