Recombinant Human Pro-neuregulin-2, membrane-bound isoform (NRG2), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC24852
Artikelname: Recombinant Human Pro-neuregulin-2, membrane-bound isoform (NRG2), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC24852
Hersteller Artikelnummer: RPC24852
Alternativnummer: BIM-RPC24852-20UG,BIM-RPC24852-100UG,BIM-RPC24852-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Divergent of neuregulin-1DON-1Neural- and thymus-derived activator for ERBB kinasesNTAK
Recombinant Human Pro-neuregulin-2, membrane-bound isoform (NRG2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: NRG2. Target Synonyms: Divergent of neuregulin-1DON-1Neural- and thymus-derived activator for ERBB kinasesNTAK. Accession Number: O14511. Expression Region: 112~405aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 34.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 34.8kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGIN
Target-Kategorie: NRG2