Recombinant Human Pro-neuregulin-2, membrane-bound isoform (NRG2), partial, Unconjugated, Yeast

Catalog Number: BIM-RPC24852
Article Name: Recombinant Human Pro-neuregulin-2, membrane-bound isoform (NRG2), partial, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC24852
Supplier Catalog Number: RPC24852
Alternative Catalog Number: BIM-RPC24852-20UG,BIM-RPC24852-100UG,BIM-RPC24852-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Divergent of neuregulin-1DON-1Neural- and thymus-derived activator for ERBB kinasesNTAK
Recombinant Human Pro-neuregulin-2, membrane-bound isoform (NRG2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: NRG2. Target Synonyms: Divergent of neuregulin-1DON-1Neural- and thymus-derived activator for ERBB kinasesNTAK. Accession Number: O14511. Expression Region: 112~405aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 34.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 34.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGIN
Target: NRG2